Skip to content

NEW  Coming soon: ask your fleet a question and get an answer — an MCP server for AI.  Read more →

2026-08-07 · UTC

Internet weather report

A daily read on the public networks the remote.it fleet connects over —
Friday, August 7, 2026, worldwide. Global internet: operating normally.

Not a remote.it status page — a snapshot of the local networks our devices connect over. “Stormy” means internet connections there are running well below what an always-on connection should deliver — never a remote.it outage.

Today's outlook

Four forecasts, one fleet.

Internet health, 0–100 — scored on always-on devices, where every drop is real.

Cellular
LTE / 4G / 5G
95 internet health
7-day history

50% of devices always-on · 99.5% avg uptime

Fleet
50k+
Time online
66.3%
Starlink
LEO satellite
97 internet health
7-day history

59% of devices always-on · 99.3% avg uptime

Fleet
10k+
Time online
75.2%
Broadband
Cable · DSL · fiber
98 internet health
7-day history

78% of devices always-on · 99.7% avg uptime

Fleet
50k+
Time online
86.2%
This week

The last seven days.

Global internet health, one point per day, with a 7-day average line smoothing the weekday/weekend rhythm of duty-cycled fleets. History builds forward — the report keeps a rolling daily series.

Global internet health · last 7 days
758392100⛈️SatSunMon⛈️Tue⛈️Wed⛈️Thu⛈️Today

One point per day. The line upgrades from the whole-fleet health score to the always-on series as history accrues. The thin line is the trailing 7-day average — it smooths the weekday/weekend rhythm of duty-cycled fleets, so what moves it is real.

Global internet health · last 7 days
DateInternet health7-day averageTime onlineConditions
Saturday, August 18485.178.7%Stormy
Sunday, August 29085.189.7%Partly cloudy
Monday, August 39185.390.2%Partly cloudy
Tuesday, August 48485.474.9%Stormy
Wednesday, August 58385.475.4%Stormy
Thursday, August 68385.476.5%Stormy
Friday, August 78385.476.9%Stormy
World

Internet health by country.

Each country shaded by its internet health. Grey means no reporting fleet today.

Simple World MapAuthor: Al MacDonald Editor: Fritz Lekschas License: CC BY-SA 3.0 ID: ISO 3166-1 or "_[a-zA-Z]" if an ISO code is not available
60 100 no data internet health
Networks
1 Japan +1.0 vs normal 100 1.0 C S B
2 Slovakia -3.0 vs normal 100 2.0 C S B
3 Czechia 0.0 vs normal 100 1.0 C S B
4 Finland +2.0 vs normal 100 1.0 C B
5 Iceland -2.0 vs normal 100 3.0 C B
6 Luxembourg 0.0 vs normal 100 0.0 C B
7 South Korea +2.0 vs normal 100 3.0 C B
8 Guatemala 0.0 vs normal 100 1.0 C S B
9 Latvia 0.0 vs normal 100 6.0 C B
10 Romania +4.0 vs normal 100 4.0 C B
11 Hong Kong SAR China -1.0 vs normal 100 1.0 C B
12 Slovenia 0.0 vs normal 100 1.0 C B
13 Hungary -1.0 vs normal 100 1.0 C B
14 Serbia -1.0 vs normal 100 0.0 C B
15 Maldives 0.0 vs normal 100 4.0 C B
16 El Salvador 0.0 vs normal 100 0.0 C B
17 Jordan 0.0 vs normal 100 2.0 C S B
18 Cyprus +2.0 vs normal 100 8.0 C B
19 Puerto Rico -8.0 vs normal 100 1.0 S B
20 Belarus -1.0 vs normal 100 1.0 C B
21 Cambodia +7.0 vs normal 100 7.0 B
22 Paraguay -4.0 vs normal 100 0.0 B
23 Tanzania -11.0 vs normal 100 3.0 C
24 Oman +5.0 vs normal 100 3.0 C B
25 Nepal +3.0 vs normal 100 3.0 B
26 Myanmar (Burma) +1.0 vs normal 100 7.0 C B
27 Tunisia -1.0 vs normal 100 5.0 C B
28 Bahamas 0.0 vs normal 100 0.0 B
29 Sri Lanka +8.0 vs normal 100 1.0 B
30 Faroe Islands +9.0 vs normal 100 9.0 C
31 New Caledonia +2.0 vs normal 100 10.0 C B
32 Nicaragua +7.0 vs normal 100 0.0 C S
33 Bahrain +7.0 vs normal 100 7.0 C B
34 Trinidad & Tobago 0.0 vs normal 100 0.0 B
35 Kazakhstan +5.0 vs normal 100 5.0 C B
36 Tonga 0.0 vs normal 100 0.0 C
37 Montenegro 0.0 vs normal 100 0.0 C B
38 U.S. Virgin Islands 0.0 vs normal 100 0.0 S B
39 Zambia 0.0 vs normal 100 0.0 S
40 Jamaica -8.0 vs normal 100 8.0 C S B
41 Namibia +14.0 vs normal 100 14.0 B
42 French Polynesia 0.0 vs normal 100 0.0 B
43 Uganda 0.0 vs normal 100 0.0 C B
44 Georgia 100 12.0 C
45 Angola 100 12.0 C B
46 Australia -1.0 vs normal 99 1.0 C S B
47 Sweden -1.0 vs normal 99 4.0 C S B
48 Netherlands +1.0 vs normal 99 2.0 C S B
49 Austria -1.0 vs normal 99 1.0 C S B
50 Mexico -1.0 vs normal 99 1.0 C S B
51 Norway -3.0 vs normal 99 5.0 C S B
52 Denmark -1.0 vs normal 99 6.0 C S B
53 Poland -1.0 vs normal 99 0.0 C S B
54 Ireland -1.0 vs normal 99 1.0 C S B
55 Belgium -5.0 vs normal 99 5.0 C S B
56 Switzerland +1.0 vs normal 99 2.0 C S B
57 Malaysia 0.0 vs normal 99 1.0 C S B
58 Lithuania +11.0 vs normal 99 13.0 C B
59 Israel +1.0 vs normal 99 0.0 C B
60 Portugal -2.0 vs normal 99 2.0 C S B
61 Ecuador -1.0 vs normal 99 1.0 C S B
62 Argentina +1.0 vs normal 99 5.0 C S B
63 Malta -2.0 vs normal 99 3.0 C B
64 Qatar -1.0 vs normal 99 1.0 C B
65 United States -1.0 vs normal 98 1.0 C S B
66 United Kingdom -1.0 vs normal 98 1.0 C S B
67 Germany 0.0 vs normal 98 2.0 C S B
68 Italy 0.0 vs normal 98 1.0 C S B
69 Colombia 0.0 vs normal 98 1.0 C S B
70 Chile 0.0 vs normal 98 0.0 C S B
71 Philippines -2.0 vs normal 98 0.0 C S B
72 Estonia +1.0 vs normal 98 0.0 C B
73 Jersey -1.0 vs normal 98 3.0 B
74 Ukraine 0.0 vs normal 98 3.0 C S B
75 Greece -1.0 vs normal 98 4.0 C S B
76 Egypt -1.0 vs normal 98 3.0 C B
77 Taiwan 0.0 vs normal 98 2.0 C B
78 Croatia -1.0 vs normal 98 1.0 C B
79 Panama -6.0 vs normal 98 6.0 S B
80 Iran -4.0 vs normal 98 4.0 C B
81 Costa Rica -3.0 vs normal 98 2.0 S B
82 Bolivia -1.0 vs normal 98 4.0 C S B
83 Kuwait 0.0 vs normal 98 7.0 C B
84 Isle of Man -5.0 vs normal 98 9.0 C B
85 Mongolia -5.0 vs normal 98 4.0 C B
86 Honduras 0.0 vs normal 98 9.0 B
87 Canada 0.0 vs normal 97 0.0 C S B
88 Thailand +2.0 vs normal 97 5.0 C B
89 Spain +2.0 vs normal 97 3.0 C S B
90 Indonesia -4.0 vs normal 97 4.0 C S B
91 Türkiye -2.0 vs normal 97 1.0 C B
92 Saudi Arabia -1.0 vs normal 97 7.0 C B
93 Vietnam 0.0 vs normal 97 1.0 C B
94 Venezuela -1.0 vs normal 97 0.0 S B
95 Bosnia & Herzegovina -5.0 vs normal 97 5.0 B
96 France +2.0 vs normal 96 2.0 C S B
97 Guernsey 0.0 vs normal 96 2.0 C B
98 Pakistan 0.0 vs normal 96 3.0 C B
99 Senegal -9.0 vs normal 96 3.0 C
100 Brazil -1.0 vs normal 95 1.0 C S B
101 Morocco +2.0 vs normal 95 3.0 C B
102 Singapore -1.0 vs normal 94 1.0 C B
103 New Zealand -2.0 vs normal 94 4.0 C S B
104 South Africa -4.0 vs normal 94 4.0 C B
105 United Arab Emirates -1.0 vs normal 94 1.0 C B
106 Dominican Republic -8.0 vs normal 94 5.0 C S B
107 Bulgaria +3.0 vs normal · -5 vs always-on standard 93 6.0 C S B
108 Kenya -6.0 vs normal · -5 vs always-on standard 93 5.0 C S B
109 Uruguay -9.0 vs normal · -5 vs always-on standard 93 2.0 B
110 Côte d’Ivoire +6.0 vs normal · -5 vs always-on standard 93 11.0 C B
111 Nigeria -6.0 vs normal · -6 vs always-on standard 92 10.0 C S B
112 India 0.0 vs normal · -8 vs always-on standard 90 0.0 C B
113 Iraq +4.0 vs normal · -9 vs always-on standard 89 2.0 C B
114 China -6.0 vs normal · -10 vs always-on standard 88 10.0 C B
115 Papua New Guinea 0.0 vs normal · -10 vs always-on standard 88 0.0 C B
116 Peru -1.0 vs normal · -12 vs always-on standard 86 0.0 C S B
117 Cameroon -12 vs always-on standard 86 5.3 S
118 Bangladesh +6.0 vs normal · -14 vs always-on standard 84 3.0 C B
119 Ghana -3.0 vs normal · -18 vs always-on standard 80 2.0 C B
120 Russia +4.0 vs normal · -25 vs always-on standard 73 7.0 C B
121 Yemen -4.0 vs normal · -26 vs always-on standard 72 9.0 S B
122 Greenland +1.0 vs normal 69 2.0 C
123 Réunion -12.0 vs normal 44 17.0 C
United States

Internet health by state.

All 50 states and DC shaded by internet health — Alaska and Hawaii inset at lower left. Territories appear in the table.

TXCAMTNMAZNVCOWYORUTMNIDKSSDNEAKNDOKMOWAGAFLMIILIAWIARALNCNYMSLAPATNOHVAKYINMESCWVMDVTNHMANJHICTDERIDC
60 100 no data internet health
Networks
1 Kentucky 0.0 vs normal 100 4.0 C S B
2 Iowa -10.0 vs normal 100 10.0 C S B
3 Montana -2.0 vs normal 100 3.0 S B
4 Delaware -1.0 vs normal 100 1.0 C S B
5 Alaska +2.0 vs normal 100 3.0 C S B
6 South Dakota +6.0 vs normal 100 6.0 S B
7 North Dakota -7.0 vs normal 100 4.0 S B
8 Texas 0.0 vs normal 99 0.0 C S B
9 California 0.0 vs normal 99 0.0 C S B
10 Georgia -1.0 vs normal 99 1.0 C S B
11 Florida -5.0 vs normal 99 6.0 C S B
12 Illinois -1.0 vs normal 99 2.0 C S B
13 Massachusetts -1.0 vs normal 99 0.0 C S B
14 Ohio 0.0 vs normal 99 0.0 C S B
15 Wisconsin 0.0 vs normal 99 1.0 C S B
16 Pennsylvania -4.0 vs normal 99 5.0 C S B
17 Arizona -1.0 vs normal 99 0.0 C S B
18 Utah -1.0 vs normal 99 1.0 C S B
19 Nebraska -2.0 vs normal 99 2.0 C S B
20 South Carolina -1.0 vs normal 99 2.0 C S B
21 Indiana +1.0 vs normal 99 0.0 C S B
22 Connecticut -2.0 vs normal 99 3.0 C S B
23 Idaho -1.0 vs normal 99 1.0 C S B
24 Hawaii +1.0 vs normal 99 1.0 C S B
25 Missouri +2.0 vs normal 99 4.0 C S B
26 Alabama -1.0 vs normal 99 1.0 C S B
27 Oklahoma -1.0 vs normal 99 2.0 C S B
28 Vermont -1.0 vs normal 99 1.0 S B
29 New Hampshire 0.0 vs normal 99 0.0 S B
30 Maine -1.0 vs normal 99 3.0 S B
31 Rhode Island -1.0 vs normal 99 10.0 C B
32 Arkansas -1.0 vs normal 99 1.0 C S B
33 Washington 0.0 vs normal 98 1.0 C S B
34 Virginia -1.0 vs normal 98 1.0 C S B
35 Colorado 0.0 vs normal 98 0.0 C S B
36 New York 0.0 vs normal 98 0.0 C S B
37 Minnesota -2.0 vs normal 98 3.0 C S B
38 New Jersey 0.0 vs normal 98 0.0 C S B
39 North Carolina -1.0 vs normal 98 4.0 C S B
40 Tennessee -1.0 vs normal 98 0.0 C S B
41 Michigan -2.0 vs normal 98 2.0 C S B
42 Nevada 0.0 vs normal 98 1.0 C S B
43 District of Columbia -7.0 vs normal 98 7.0 C B
44 Maryland -3.0 vs normal 98 3.0 C S B
45 Kansas -1.0 vs normal 98 5.0 C S B
46 Louisiana +2.0 vs normal 98 1.0 C S B
47 New Mexico -3.0 vs normal 98 3.0 C S B
48 West Virginia -5.0 vs normal 98 0.0 S B
49 Wyoming -1.0 vs normal 98 5.0 S B
50 Mississippi +2.0 vs normal 96 2.0 C S B
51 Oregon -2.0 vs normal · -7 vs always-on standard 91 2.0 C S B

How we grade the weather

We grade a connection by how often it drops while the device is online — reconnects per online-hour — not by raw connectivity, so a device that sleeps to save power isn't punished for being offline by design. Internet health is that grade measured on always-on devices (online 90%+ of the day, for whom a reconnect is a real drop, never a scheduled wake), scored 0–100 against what a perfect always-on connection would deliver. Icons and statuses follow that number on one absolute scale — Clear at 95+, Partly cloudy from 85, Stormy below — the same bar for every region, so “stormy” always means the internet there is genuinely below standard, never “below its own usual”. Movement against a region's own recent trend appears as a secondary note (“vs its usual trend”), not as the weather itself. A brand-new region — or a group too small to have an always-on cohort — reports on its whole-fleet composite until one exists. The bar on each row is the grade mix; the percentage beside it is average time connected — a separate axis.

Today, and the last 24 hours

Each report covers the last 24 hours of devices seen — today's active fleet, not a rolling week — so the trend actually moves day to day. Average time online includes devices that sleep by design, which is why it undersells the fleet: the honest infrastructure story is the always-on share — the portion of devices online 90%+ of the day — and that cohort's uptime, both plain distribution facts with nothing excluded. The same duty-cycling gives the daily series a weekday/weekend rhythm (more sleepy devices report on weekdays); the 7-day average line above smooths exactly that. We report cellular vs. Starlink as an observed difference, not a verdict — usage and power still color it. And if most regions ever dip at once, we flag the day as a data anomaly instead of a global storm — the internet doesn't fail everywhere simultaneously, but a measurement pipeline can.

Confidence, privacy & sources

The Sample dots show how much data backs a row — a larger device sample means a more reliable average (we never publish exact counts). Tables are ordered by the internet-health figure shown, with nothing hidden behind it — so a region running on a handful of always-on devices can sit near the top on thin evidence. Check its dots before drawing a conclusion. Aggregates only: any region with fewer than 20 devices is omitted, and a network-class row within a region needs at least 5 devices — below that, an “average” is close to one device's raw telemetry; no counts, IPs, or user data are ever published. World map: “Simple World Map” by Al MacDonald / Fritz Lekschas, CC BY-SA 3.0. US geometry: public-domain US Census cartographic boundaries (us-atlas).

Generated 2026-08-07T00:31:26.817Z · powered by remote.it

Search articles