Skip to content

NEW  Coming soon: ask your fleet a question and get an answer — an MCP server for AI.  Read more →

2026-08-11 · UTC

Internet weather report

A daily read on the public networks the remote.it fleet connects over —
Tuesday, August 11, 2026, worldwide. Global internet: operating normally.

Not a remote.it status page — a snapshot of the local networks our devices connect over. “Stormy” means internet connections there are running well below what an always-on connection should deliver — never a remote.it outage.

Today's outlook

Four forecasts, one fleet.

Internet health, 0–100 — scored on always-on devices, where every drop is real.

Cellular
LTE / 4G / 5G
95 internet health
7-day history

51% of devices always-on · 99.5% avg uptime

Fleet
50k+
Time online
62.5%
Starlink
LEO satellite
98 internet health
7-day history

59% of devices always-on · 99.5% avg uptime

Fleet
10k+
Time online
73.0%
Broadband
Cable · DSL · fiber
98 internet health
7-day history

80% of devices always-on · 99.7% avg uptime

Fleet
50k+
Time online
85.8%
This week

The last seven days.

Global internet health, one point per day, with a 7-day average line smoothing the weekday/weekend rhythm of duty-cycled fleets. History builds forward — the report keeps a rolling daily series.

Global internet health · last 7 days
758392100⛈️Wed⛈️Thu⛈️Fri⛈️SatSunMon⛈️Today

One point per day. The line upgrades from the whole-fleet health score to the always-on series as history accrues. The thin line is the trailing 7-day average — it smooths the weekday/weekend rhythm of duty-cycled fleets, so what moves it is real.

Global internet health · last 7 days
DateInternet health7-day averageTime onlineConditions
Wednesday, August 58385.475.4%Stormy
Thursday, August 68385.476.5%Stormy
Friday, August 78385.476.9%Stormy
Saturday, August 88485.478.3%Stormy
Sunday, August 99085.489.5%Partly cloudy
Monday, August 109185.491.6%Partly cloudy
Tuesday, August 118485.475.0%Stormy
World

Internet health by country.

Each country shaded by its internet health. Grey means no reporting fleet today.

Simple World MapAuthor: Al MacDonald Editor: Fritz Lekschas License: CC BY-SA 3.0 ID: ISO 3166-1 or "_[a-zA-Z]" if an ISO code is not available
60 100 no data internet health
Networks
1 Japan +4.0 vs normal 100 5.0 C S B
2 Poland -1.0 vs normal 100 1.0 C S B
3 Czechia -1.0 vs normal 100 1.0 C S B
4 Finland -2.0 vs normal 100 0.0 C B
5 Malaysia +1.0 vs normal 100 1.0 C S B
6 Luxembourg +4.0 vs normal 100 6.0 C B
7 South Korea -2.0 vs normal 100 1.0 C B
8 Guatemala +1.0 vs normal 100 1.0 C S B
9 Latvia -1.0 vs normal 100 1.0 C B
10 Hong Kong SAR China -1.0 vs normal 100 0.0 C B
11 Slovenia -1.0 vs normal 100 2.0 C B
12 Serbia -1.0 vs normal 100 1.0 C B
13 Croatia +1.0 vs normal 100 0.0 C B
14 Dominican Republic -11.0 vs normal 100 16.0 C S B
15 Nigeria -1.0 vs normal 100 1.0 C S B
16 Maldives 0.0 vs normal 100 0.0 C B
17 El Salvador -5.0 vs normal 100 6.0 C B
18 Puerto Rico -1.0 vs normal 100 1.0 S B
19 Belarus -2.0 vs normal 100 2.0 C B
20 Cambodia -1.0 vs normal 100 1.0 B
21 Faroe Islands -9.0 vs normal 100 21.0 C
22 Uruguay -2.0 vs normal 100 3.0 B
23 Paraguay -4.0 vs normal 100 3.0 B
24 Isle of Man +10.0 vs normal 100 16.0 C B
25 Oman +2.0 vs normal 100 0.0 C B
26 Tunisia -14.0 vs normal 100 16.0 C B
27 Myanmar (Burma) +13.0 vs normal 100 17.0 B
28 Sri Lanka -7.0 vs normal 100 3.0 C B
29 Nepal 0.0 vs normal 100 2.0 B
30 Bahamas 0.0 vs normal 100 0.0 B
31 Kazakhstan +3.0 vs normal 100 14.0 C B
32 Mongolia -5.0 vs normal 100 8.0 C B
33 Bahrain +6.0 vs normal 100 3.0 C B
34 Trinidad & Tobago 0.0 vs normal 100 0.0 B
35 Tonga 0.0 vs normal 100 0.0 C
36 New Caledonia +3.0 vs normal 100 7.0 C B
37 Montenegro 0.0 vs normal 100 0.0 C B
38 Zambia +8.0 vs normal 100 29.0 S
39 Libya 100 12.0 C B
40 U.S. Virgin Islands 0.0 vs normal 100 0.0 S B
41 Honduras +7.0 vs normal 100 7.0 B
42 Angola 100 15.0 C B
43 Caribbean Netherlands 100 5.8 S
44 French Polynesia 0.0 vs normal 100 0.0 B
45 Congo - Brazzaville 100 6.0 B
46 Mauritius -9.0 vs normal 100 12.0 B
47 Namibia -2.0 vs normal 100 2.0 C B
48 Germany -1.0 vs normal 99 1.0 C S B
49 Australia +4.0 vs normal 99 4.0 C S B
50 Sweden -3.0 vs normal 99 0.0 C S B
51 Austria -1.0 vs normal 99 0.0 C S B
52 Mexico -2.0 vs normal 99 2.0 C S B
53 Norway -4.0 vs normal 99 1.0 C S B
54 Denmark -4.0 vs normal 99 1.0 C S B
55 Belgium -6.0 vs normal 99 1.0 C S B
56 Switzerland -1.0 vs normal 99 0.0 C S B
57 Ireland +1.0 vs normal 99 2.0 C S B
58 Chile 0.0 vs normal 99 1.0 C S B
59 Lithuania +3.0 vs normal 99 3.0 C B
60 Portugal 0.0 vs normal 99 0.0 C S B
61 Türkiye -1.0 vs normal 99 2.0 C B
62 Romania -2.0 vs normal 99 0.0 C B
63 Saudi Arabia 0.0 vs normal 99 0.0 C B
64 Ecuador +5.0 vs normal 99 9.0 C S B
65 Greece +1.0 vs normal 99 2.0 C S B
66 Hungary -3.0 vs normal 99 2.0 C B
67 Cyprus 0.0 vs normal 99 1.0 C B
68 United States -1.0 vs normal 98 0.0 C S B
69 United Kingdom 0.0 vs normal 98 0.0 C S B
70 Italy +4.0 vs normal 98 4.0 C S B
71 Thailand +2.0 vs normal 98 2.0 C B
72 Colombia -2.0 vs normal 98 2.0 C S B
73 Spain +1.0 vs normal 98 2.0 C S B
74 Slovakia -3.0 vs normal 98 4.0 C S B
75 Indonesia 0.0 vs normal 98 0.0 C S B
76 Israel 0.0 vs normal 98 1.0 C B
77 Estonia -2.0 vs normal 98 1.0 C B
78 Vietnam +3.0 vs normal 98 3.0 C B
79 Ukraine -5.0 vs normal 98 5.0 C S B
80 Argentina -4.0 vs normal 98 2.0 C S B
81 Venezuela +1.0 vs normal 98 2.0 C S B
82 Kenya 0.0 vs normal 98 2.0 C S B
83 Costa Rica -5.0 vs normal 98 5.0 S B
84 Bolivia -2.0 vs normal 98 2.0 C S B
85 Senegal -6.0 vs normal 98 3.0 C
86 Jordan -2.0 vs normal 98 2.0 C B
87 Kuwait 0.0 vs normal 98 34.0 C B
88 Qatar 0.0 vs normal 98 2.0 C B
89 Brazil 0.0 vs normal 97 0.0 C S B
90 Iceland -2.0 vs normal 97 2.0 C B
91 Philippines +1.0 vs normal 97 0.0 C S B
92 Jersey -3.0 vs normal 97 3.0 B
93 Bulgaria -2.0 vs normal 97 5.0 C S B
94 Panama -4.0 vs normal 97 6.0 S B
95 Bosnia & Herzegovina 0.0 vs normal 97 0.0 B
96 Netherlands 0.0 vs normal 96 0.0 C S B
97 Canada -1.0 vs normal 96 0.0 C S B
98 France 0.0 vs normal 96 1.0 C S B
99 Pakistan -2.0 vs normal 96 2.0 C B
100 Taiwan -1.0 vs normal 96 1.0 C B
101 Malta -2.0 vs normal 96 9.0 C B
102 Morocco -7.0 vs normal 96 6.0 C B
103 Cameroon 96 29.0 S
104 New Zealand 0.0 vs normal 95 3.0 C S B
105 South Africa 0.0 vs normal 95 5.0 C B
106 Guernsey -1.0 vs normal 95 1.0 C B
107 Iran -1.0 vs normal 95 4.0 C B
108 Côte d’Ivoire 0.0 vs normal 95 1.0 C B
109 Tanzania -2.0 vs normal 95 1.0 C
110 Singapore 0.0 vs normal 94 1.0 C B
111 Georgia +9.0 vs normal 94 19.0 C
112 United Arab Emirates -2.0 vs normal · -5 vs always-on standard 93 2.0 C B
113 Egypt -3.0 vs normal · -5 vs always-on standard 93 0.0 C B
114 Yemen +2.0 vs normal · -6 vs always-on standard 92 2.0 S B
115 Lebanon -7 vs always-on standard 91 8.0 B
116 India 0.0 vs normal · -8 vs always-on standard 90 0.0 C B
117 China -2.0 vs normal · -8 vs always-on standard 90 0.0 C B
118 Nicaragua +11.0 vs normal · -10 vs always-on standard 88 11.0 C S B
119 Peru 0.0 vs normal · -16 vs always-on standard 82 0.0 C S B
120 Bangladesh -3.0 vs normal · -16 vs always-on standard 82 0.0 C B
121 Iraq 0.0 vs normal · -17 vs always-on standard 81 2.0 C B
122 Ghana -5.0 vs normal · -18 vs always-on standard 80 7.0 C
123 Russia +7.0 vs normal · -19 vs always-on standard 79 7.0 C B
124 Papua New Guinea -15.0 vs normal · -32 vs always-on standard 66 20.0 C B
125 Moldova 59 3.8 B
126 Réunion +4.0 vs normal 56 4.0 C
127 Greenland -20.0 vs normal 48 10.0 C
United States

Internet health by state.

All 50 states and DC shaded by internet health — Alaska and Hawaii inset at lower left. Territories appear in the table.

TXCAMTNMAZNVCOWYORUTMNIDKSSDNEAKNDOKMOWAGAFLMIILIAWIARALNCNYMSLAPATNOHVAKYINMESCWVMDVTNHMANJHICTDERIDC
60 100 no data internet health
Networks
1 Kentucky +1.0 vs normal 100 1.0 C S B
2 Iowa -6.0 vs normal 100 5.0 C S B
3 Montana -1.0 vs normal 100 2.0 S B
4 New Mexico -2.0 vs normal 100 4.0 C S B
5 Rhode Island 0.0 vs normal 100 3.0 C S B
6 Alaska +6.0 vs normal 100 6.0 C S B
7 Wyoming +3.0 vs normal 100 4.0 S B
8 North Dakota -6.0 vs normal 100 6.0 S B
9 South Dakota +1.0 vs normal 100 7.0 S B
10 Texas 0.0 vs normal 99 0.0 C S B
11 California 0.0 vs normal 99 1.0 C S B
12 Georgia -2.0 vs normal 99 1.0 C S B
13 Florida -5.0 vs normal 99 0.0 C S B
14 Washington 0.0 vs normal 99 1.0 C S B
15 Illinois -2.0 vs normal 99 0.0 C S B
16 Massachusetts -2.0 vs normal 99 1.0 C S B
17 Minnesota -2.0 vs normal 99 2.0 C S B
18 Tennessee -1.0 vs normal 99 0.0 C S B
19 Ohio 0.0 vs normal 99 0.0 C S B
20 Pennsylvania -4.0 vs normal 99 0.0 C S B
21 Wisconsin -2.0 vs normal 99 2.0 C S B
22 Utah -1.0 vs normal 99 1.0 C S B
23 Michigan -1.0 vs normal 99 0.0 C S B
24 Nebraska -4.0 vs normal 99 4.0 C S B
25 South Carolina 0.0 vs normal 99 2.0 C S B
26 Maryland -2.0 vs normal 99 1.0 C S B
27 Connecticut -3.0 vs normal 99 2.0 C S B
28 Missouri -2.0 vs normal 99 1.0 C S B
29 Idaho 0.0 vs normal 99 0.0 C S B
30 Hawaii 0.0 vs normal 99 1.0 C S B
31 Alabama -1.0 vs normal 99 1.0 C S B
32 Oklahoma -2.0 vs normal 99 1.0 C S B
33 Vermont -2.0 vs normal 99 0.0 S B
34 New Hampshire +1.0 vs normal 99 1.0 S B
35 Maine -4.0 vs normal 99 4.0 S B
36 Arkansas -2.0 vs normal 99 1.0 C S B
37 Virginia -1.0 vs normal 98 0.0 C S B
38 Colorado 0.0 vs normal 98 0.0 C S B
39 New York -1.0 vs normal 98 1.0 C S B
40 New Jersey 0.0 vs normal 98 0.0 C S B
41 North Carolina -1.0 vs normal 98 0.0 C S B
42 Arizona -1.0 vs normal 98 1.0 C S B
43 Nevada -1.0 vs normal 98 0.0 C S B
44 District of Columbia 0.0 vs normal 98 0.0 C B
45 Kansas -1.0 vs normal 98 1.0 C S B
46 Louisiana -22.0 vs normal 98 20.0 C S B
47 Mississippi -2.0 vs normal 98 2.0 C S B
48 Delaware -5.0 vs normal 98 2.0 C S B
49 West Virginia 0.0 vs normal 98 0.0 S B
50 Indiana -3.0 vs normal 96 1.0 C S B
51 Oregon 0.0 vs normal · -6 vs always-on standard 92 0.0 C S B

How we grade the weather

We grade a connection by how often it drops while the device is online — reconnects per online-hour — not by raw connectivity, so a device that sleeps to save power isn't punished for being offline by design. Internet health is that grade measured on always-on devices (online 90%+ of the day, for whom a reconnect is a real drop, never a scheduled wake), scored 0–100 against what a perfect always-on connection would deliver. Icons and statuses follow that number on one absolute scale — Clear at 95+, Partly cloudy from 85, Stormy below — the same bar for every region, so “stormy” always means the internet there is genuinely below standard, never “below its own usual”. Movement against a region's own recent trend appears as a secondary note (“vs its usual trend”), not as the weather itself. A brand-new region — or a group too small to have an always-on cohort — reports on its whole-fleet composite until one exists. The bar on each row is the grade mix; the percentage beside it is average time connected — a separate axis.

Today, and the last 24 hours

Each report covers the last 24 hours of devices seen — today's active fleet, not a rolling week — so the trend actually moves day to day. Average time online includes devices that sleep by design, which is why it undersells the fleet: the honest infrastructure story is the always-on share — the portion of devices online 90%+ of the day — and that cohort's uptime, both plain distribution facts with nothing excluded. The same duty-cycling gives the daily series a weekday/weekend rhythm (more sleepy devices report on weekdays); the 7-day average line above smooths exactly that. We report cellular vs. Starlink as an observed difference, not a verdict — usage and power still color it. And if most regions ever dip at once, we flag the day as a data anomaly instead of a global storm — the internet doesn't fail everywhere simultaneously, but a measurement pipeline can.

Confidence, privacy & sources

The Sample dots show how much data backs a row — a larger device sample means a more reliable average (we never publish exact counts). Tables are ordered by the internet-health figure shown, with nothing hidden behind it — so a region running on a handful of always-on devices can sit near the top on thin evidence. Check its dots before drawing a conclusion. Aggregates only: any region with fewer than 20 devices is omitted, and a network-class row within a region needs at least 5 devices — below that, an “average” is close to one device's raw telemetry; no counts, IPs, or user data are ever published. World map: “Simple World Map” by Al MacDonald / Fritz Lekschas, CC BY-SA 3.0. US geometry: public-domain US Census cartographic boundaries (us-atlas).

Generated 2026-08-11T00:31:27.707Z · powered by remote.it

Search articles