Skip to content

NEW  Coming soon: ask your fleet a question and get an answer — an MCP server for AI.  Read more →

2026-09-20 · UTC

Internet weather report

A daily read on the public networks the remote.it fleet connects over —
Sunday, September 20, 2026, worldwide. Global internet: operating normally.

Not a remote.it status page — we measure the local networks our devices connect over. “Stormy” means the internet there is running well below what an always-on connection should deliver, or that far more of its always-on devices are offline than usual.

Today's outlook

Four forecasts, one fleet.

Internet health, 0–100 — scored on always-on devices, where every drop is real.

Cellular
LTE / 4G / 5G
95 internet health
7-day history
Always-on
74%
Avg uptime
99.5%
Fleet
50k+
Time online
83.6%
Starlink
LEO satellite
98 internet health
7-day history
Always-on
67%
Avg uptime
99.5%
Fleet
10k+
Time online
82.7%
Broadband
Cable · DSL · fiber
98 internet health
7-day history
Always-on
89%
Avg uptime
99.8%
Fleet
50k+
Time online
93.5%
This week

The last seven days.

One point per day. The bands are the fleet's daily grade mix — that's where its weekday/weekend rhythm shows — while the health line holds to the always-on standard.

5075100☀️Mon☀️Tue☀️Wed☀️Thu☀️Fri☀️Sat☀️Today
Global Internet Health · Last 7 Days
DateInternet healthFleet mixTime onlineConditions
Monday, September 149787/7/689.9%Clear
Tuesday, September 159778/12/1173.2%Clear
Wednesday, September 169777/12/1074.7%Clear
Thursday, September 179777/12/1075.5%Clear
Friday, September 189778/12/1076.4%Clear
Saturday, September 199778/12/1077.8%Clear
Sunday, September 209786/8/689.5%Clear
World

Internet health by country.

Shaded by internet health. Grey means no always-on cohort to grade today, or no reporting fleet.

Simple World MapAuthor: Al MacDonald Editor: Fritz Lekschas License: CC BY-SA 3.0 ID: ISO 3166-1 or "_[a-zA-Z]" if an ISO code is not available
60 100 No data internet health
Networks
1 Japan +6.5 vs normal 100 3.0 7-day fleet-score change +3.0 pts · range 86–94 C S B
2 Netherlands +10.0 vs normal 100 7.0 7-day fleet-score change -7.0 pts · range 72–90 C S B
3 Norway +8.0 vs normal 100 5.0 7-day fleet-score change -5.0 pts · range 80–96 C S B
4 Switzerland +23.5 vs normal 100 4.0 7-day fleet-score change -4.0 pts · range 69–98 C S B
5 Poland +15.0 vs normal 100 8.0 7-day fleet-score change -8.0 pts · range 64–88 C S B
6 Czechia +12.0 vs normal 100 2.0 7-day fleet-score change -2.0 pts · range 71–91 C S B
7 Iceland -2.5 vs normal 100 5.0 7-day fleet-score change -5.0 pts · range 80–85 C B
8 Portugal +13.0 vs normal 100 4.0 7-day fleet-score change +4.0 pts · range 71–96 C S B
9 Romania +1.0 vs normal 100 13.0 7-day fleet-score change -13.0 pts · range 70–88 C B
10 Luxembourg +16.5 vs normal 100 17.0 7-day fleet-score change -17.0 pts · range 53–88 C B
11 Argentina +3.0 vs normal 100 4.0 7-day fleet-score change -4.0 pts · range 81–94 C S B
12 Hungary +4.5 vs normal 100 7.0 7-day fleet-score change -7.0 pts · range 76–98 C B
13 Lithuania +16.5 vs normal 100 11.0 7-day fleet-score change -11.0 pts · range 64–93 C B
14 Bulgaria +3.0 vs normal 100 3.0 7-day fleet-score change -3.0 pts · range 75–85 C S B
15 Egypt -1.5 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 82–88 C B
16 Latvia +17.0 vs normal 100 12.0 7-day fleet-score change -12.0 pts · range 65–97 C B
17 Bolivia -1.0 vs normal 100 2.0 7-day fleet-score change -2.0 pts · range 96–98 C S B
18 Costa Rica +5.0 vs normal 100 3.0 7-day fleet-score change +3.0 pts · range 91–97 S B
19 Nigeria +3.0 vs normal 100 8.0 7-day fleet-score change +8.0 pts · range 60–72 C S B
20 Belarus -4.0 vs normal 100 4.0 7-day fleet-score change -4.0 pts · range 96–100 C B
21 Serbia -3.0 vs normal 100 3.0 7-day fleet-score change -3.0 pts · range 85–96 C B
22 Cambodia +4.0 vs normal 100 5.0 7-day fleet-score change +5.0 pts · range 87–96 B
23 Puerto Rico +4.5 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 91–96 S B
24 Kuwait +1.5 vs normal 100 2.0 7-day fleet-score change +2.0 pts · range 89–95 C B
25 Zimbabwe +23.0 vs normal 100 7.0 7-day fleet-score change +7.0 pts · range 10–60 S
26 Jordan 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 95–98 C B
27 Qatar +1.0 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 94–98 C B
28 Tanzania +1.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 74–85 C
29 Oman -6.0 vs normal 100 11.0 7-day fleet-score change -11.0 pts · range 86–97 C B
30 Nepal -5.0 vs normal 100 7.0 7-day fleet-score change -7.0 pts · range 88–98 B
31 Tunisia +1.0 vs normal 100 11.0 7-day fleet-score change -11.0 pts · range 84–98 C B
32 Nicaragua +3.0 vs normal 100 15.0 7-day fleet-score change -15.0 pts · range 56–89 C S B
33 Maldives -5.0 vs normal 100 10.0 7-day fleet-score change -10.0 pts · range 71–96 C B
34 Bahamas 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts B
35 Honduras +1.5 vs normal 100 3.0 7-day fleet-score change -3.0 pts · range 85–95 S B
36 Guyana -5.0 vs normal 100 19.0 7-day fleet-score change -19.0 pts · range 70–92 S B
37 Mongolia -2.5 vs normal 100 5.0 7-day fleet-score change -5.0 pts · range 86–95 C B
38 Congo - Brazzaville -2.5 vs normal 100 5.0 7-day fleet-score change +5.0 pts · range 80–85 B
39 Sri Lanka +2.0 vs normal 100 10.0 7-day fleet-score change +10.0 pts · range 74–90 B
40 Bahrain 0.0 vs normal 100 6.0 7-day fleet-score change +6.0 pts · range 94–100 C B
41 Tonga 0.0 vs normal 100 85.0 7-day fleet-score change +85.0 pts · range 15–100 C
42 Georgia +4.0 vs normal 100 4.0 7-day fleet-score change +4.0 pts · range 93–100 C B
43 Moldova +5.5 vs normal 100 6.0 7-day fleet-score change -6.0 pts · range 52–73 B
44 Brunei +2.0 vs normal 100 3.0 7-day fleet-score change -3.0 pts · range 81–98 B
45 Macao SAR China 100 25.0 7-day fleet-score change -25.0 pts · range 65–90 B
46 U.S. Virgin Islands 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 96–100 S B
47 Trinidad & Tobago +9.0 vs normal 100 9.0 7-day fleet-score change +9.0 pts · range 91–100 B
48 Jamaica -5.5 vs normal 100 13.0 7-day fleet-score change -13.0 pts · range 87–100 C S B
49 French Polynesia 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts B
50 Montenegro 100 0.0 7-day fleet-score change +0.0 pts C B
51 Algeria +22.0 vs normal 100 22.0 7-day fleet-score change +22.0 pts · range 61–83 C B
52 Mauritius +8.0 vs normal 100 8.0 7-day fleet-score change +8.0 pts · range 76–88 C B
53 Kazakhstan +19.0 vs normal 100 10.0 7-day fleet-score change +10.0 pts · range 65–90 C B
54 Germany +18.0 vs normal 99 2.0 7-day fleet-score change -2.0 pts · range 75–95 C S B
55 Australia +4.5 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 62–69 C S B
56 Sweden +15.0 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 80–96 C S B
57 Mexico +1.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 90–94 C S B
58 Austria +20.0 vs normal 99 7.0 7-day fleet-score change -7.0 pts · range 65–93 C S B
59 Belgium +14.5 vs normal 99 8.0 7-day fleet-score change -8.0 pts · range 70–93 C S B
60 France +13.0 vs normal 99 2.0 7-day fleet-score change -2.0 pts · range 75–93 C S B
61 Denmark +16.0 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 76–94 C B
62 Chile +1.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 90–93 C S B
63 Philippines +1.0 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 80–83 C S B
64 Malaysia 0.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 92–94 C S B
65 South Korea -1.0 vs normal 99 2.0 7-day fleet-score change -2.0 pts · range 81–84 C B
66 Finland +7.5 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 73–85 C B
67 Guatemala 0.0 vs normal 99 2.0 7-day fleet-score change -2.0 pts · range 95–99 C S B
68 Ecuador +11.0 vs normal 99 10.0 7-day fleet-score change -10.0 pts · range 72–95 C S B
69 Hong Kong SAR China +0.5 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 95–96 C B
70 Greece -1.5 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 90–93 C S B
71 Slovenia +1.0 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 97–98 C B
72 United States +4.0 vs normal 98 1.0 7-day fleet-score change -1.0 pts · range 89–94 C S B
73 United Kingdom +5.0 vs normal 98 3.0 7-day fleet-score change -3.0 pts · range 87–96 C S B
74 Italy +7.0 vs normal 98 7.0 7-day fleet-score change -7.0 pts · range 80–95 C S B
75 Slovakia +2.0 vs normal 98 0.0 7-day fleet-score change +0.0 pts · range 91–94 C S B
76 Peru +5.5 vs normal 98 14.0 7-day fleet-score change +14.0 pts · range 80–94 C S B
77 Ireland +7.0 vs normal 98 20.0 7-day fleet-score change -20.0 pts · range 59–87 C S B
78 Indonesia +1.0 vs normal 98 1.0 7-day fleet-score change -1.0 pts · range 87–90 C S B
79 Israel 0.0 vs normal 98 0.0 7-day fleet-score change +0.0 pts · range 92–94 C B
80 Vietnam 0.0 vs normal 98 1.0 7-day fleet-score change -1.0 pts · range 88–91 C B
81 Ukraine +1.0 vs normal 98 1.0 7-day fleet-score change +1.0 pts · range 91–93 C S B
82 Cyprus -6.5 vs normal 98 7.0 7-day fleet-score change -7.0 pts · range 93–100 C B
83 Croatia +5.5 vs normal 98 0.0 7-day fleet-score change +0.0 pts · range 83–93 C S B
84 El Salvador -1.0 vs normal 98 3.0 7-day fleet-score change -3.0 pts · range 89–96 C B
85 Isle of Man +1.0 vs normal 98 0.0 7-day fleet-score change +0.0 pts · range 93–98 C B
86 Canada +3.0 vs normal 97 2.0 7-day fleet-score change -2.0 pts · range 79–85 C S B
87 Colombia 0.0 vs normal 97 0.0 7-day fleet-score change +0.0 pts · range 91–93 C S B
88 Brazil +1.0 vs normal 97 2.0 7-day fleet-score change -2.0 pts · range 90–95 C S B
89 Spain +10.5 vs normal 97 5.0 7-day fleet-score change -5.0 pts · range 67–85 C S B
90 Saudi Arabia -2.0 vs normal 97 2.0 7-day fleet-score change -2.0 pts · range 83–88 C B
91 Türkiye -4.0 vs normal 97 5.0 7-day fleet-score change -5.0 pts · range 66–73 C B
92 Estonia +3.5 vs normal 97 4.0 7-day fleet-score change -4.0 pts · range 86–96 C B
93 Guernsey +15.0 vs normal 97 11.0 7-day fleet-score change -11.0 pts · range 63–91 C B
94 Malta +8.5 vs normal 97 3.0 7-day fleet-score change -3.0 pts · range 80–98 C B
95 Taiwan +1.0 vs normal 97 2.0 7-day fleet-score change +2.0 pts · range 87–93 C B
96 Panama 0.0 vs normal 97 2.0 7-day fleet-score change +2.0 pts · range 91–94 S B
97 Dominican Republic +1.0 vs normal 97 4.0 7-day fleet-score change +4.0 pts · range 78–85 C S B
98 Paraguay +4.5 vs normal 97 2.0 7-day fleet-score change -2.0 pts · range 68–81 B
99 New Zealand +11.0 vs normal 96 6.0 7-day fleet-score change +6.0 pts · range 73–85 C S B
100 South Africa +1.5 vs normal 96 6.0 7-day fleet-score change -6.0 pts · range 77–87 C B
101 Jersey +12.0 vs normal 96 1.0 7-day fleet-score change -1.0 pts · range 75–92 B
102 Pakistan +5.0 vs normal 96 2.0 7-day fleet-score change +2.0 pts · range 84–90 C B
103 Venezuela +1.5 vs normal 96 1.0 7-day fleet-score change -1.0 pts · range 82–89 C S B
104 Uruguay +22.5 vs normal 96 21.0 7-day fleet-score change +21.0 pts · range 65–90 B
105 Senegal -4.0 vs normal 95 19.0 7-day fleet-score change -19.0 pts · range 51–85 C
106 Singapore 0.0 vs normal 94 1.0 7-day fleet-score change -1.0 pts · range 86–89 C B
107 Morocco +4.5 vs normal 94 3.0 7-day fleet-score change -3.0 pts · range 78–90 C B
108 Bosnia & Herzegovina -3.0 vs normal 94 3.0 7-day fleet-score change -3.0 pts · range 76–85 C B
109 United Arab Emirates +0.5 vs normal · -6 vs always-on standard 92 1.0 7-day fleet-score change +1.0 pts · range 87–91 C B
110 India +1.0 vs normal · -7 vs always-on standard 91 0.0 7-day fleet-score change +0.0 pts · range 84–86 C B
111 China -1.0 vs normal · -7 vs always-on standard 91 2.0 7-day fleet-score change -2.0 pts · range 77–81 C B
112 Kenya -3.0 vs normal · -7 vs always-on standard 91 2.0 7-day fleet-score change +2.0 pts · range 80–89 C S B
113 Uganda -13.0 vs normal · -8 vs always-on standard 90 17.0 7-day fleet-score change -17.0 pts · range 79–98 B
114 Bangladesh +7.0 vs normal · -11 vs always-on standard 87 7.0 7-day fleet-score change +7.0 pts · range 63–85 C B
115 Côte d’Ivoire -3.5 vs normal · -13 vs always-on standard 85 3.0 7-day fleet-score change +3.0 pts · range 80–92 C B
116 Myanmar (Burma) +5.5 vs normal · -13 vs always-on standard 85 9.0 7-day fleet-score change +9.0 pts · range 56–87 B
117 Yemen -7.5 vs normal · -14 vs always-on standard 84 11.0 7-day fleet-score change -11.0 pts · range 50–96 S
118 Iraq -4.0 vs normal · -16 vs always-on standard 82 0.0 7-day fleet-score change +0.0 pts · range 69–75 C B
119 Lebanon -18.0 vs normal · -19 vs always-on standard 79 22.0 7-day fleet-score change -22.0 pts · range 66–95 B
120 Russia -8.5 vs normal · -21 vs always-on standard 77 12.0 7-day fleet-score change -12.0 pts · range 37–50 C B
121 Papua New Guinea -11.0 vs normal · -21 vs always-on standard 77 13.0 7-day fleet-score change -13.0 pts · range 70–83 C B
122 Thailand -21.0 vs normal · -22 vs always-on standard 76 21.0 7-day fleet-score change -21.0 pts · range 72–94 C B
123 Angola +9.0 vs normal · -25 vs always-on standard 73 11.0 7-day fleet-score change +11.0 pts · range 24–35 C
124 Ghana -4.0 vs normal · -31 vs always-on standard 67 2.0 7-day fleet-score change +2.0 pts · range 39–45 C
125 Iran -31.0 vs normal · -60 vs always-on standard 38 31.0 7-day fleet-score change -31.0 pts · range 19–54 C B
126 Greenland -5.5 vs normal 1.0 7-day fleet-score change +1.0 pts · range 51–76 C S

Reported Sep 19, under the 20-device floor today: Azerbaijan, Faroe Islands, New Caledonia, Réunion

United States

Internet health by state.

Shaded by internet health. Territories appear in the table.

TXCAMTNMAZNVCOWYORUTMNIDKSSDNEAKNDOKMOWAGAFLMIILIAWIARALNCNYMSLAPATNOHVAKYINMESCWVMDVTNHMANJHICTDERIDC
60 100 No data internet health
Networks
1 Mississippi +15.5 vs normal 100 7.0 7-day fleet-score change +7.0 pts · range 77–99 C S B
2 Kentucky +1.5 vs normal 100 1.0 7-day fleet-score change -1.0 pts · range 92–99 C S B
3 New Hampshire +2.0 vs normal 100 1.0 7-day fleet-score change -1.0 pts · range 95–99 C S B
4 Iowa +2.5 vs normal 100 1.0 7-day fleet-score change -1.0 pts · range 89–95 C S B
5 Montana +2.0 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 94–98 S B
6 New Mexico +1.5 vs normal 100 1.0 7-day fleet-score change -1.0 pts · range 90–97 C S B
7 Maine +3.0 vs normal 100 1.0 7-day fleet-score change -1.0 pts · range 94–99 S B
8 Arkansas +7.5 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 77–92 S B
9 Alaska +4.5 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 62–70 C S B
10 Wyoming +10.5 vs normal 100 2.0 7-day fleet-score change +2.0 pts · range 73–93 S B
11 South Dakota +5.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 76–96 S B
12 North Dakota +8.5 vs normal 100 2.0 7-day fleet-score change -2.0 pts · range 75–96 B
13 California +1.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 93–96 C S B
14 Texas +3.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 90–95 C S B
15 Georgia +3.5 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 87–92 C S B
16 Florida +5.0 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 88–97 C S B
17 Washington +2.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 93–97 C S B
18 Massachusetts +3.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 93–97 C S B
19 Illinois +8.0 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 82–92 C S B
20 New Jersey 0.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 87–89 C S B
21 Arizona +1.0 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 85–91 C S B
22 Nevada +1.0 vs normal 99 2.0 7-day fleet-score change -2.0 pts · range 89–93 C S B
23 Pennsylvania +5.0 vs normal 99 4.0 7-day fleet-score change -4.0 pts · range 85–95 C S B
24 North Carolina +6.5 vs normal 99 4.0 7-day fleet-score change -4.0 pts · range 82–94 C S B
25 Ohio +8.0 vs normal 99 4.0 7-day fleet-score change -4.0 pts · range 82–95 C S B
26 Michigan +10.0 vs normal 99 4.0 7-day fleet-score change -4.0 pts · range 80–96 C S B
27 Utah +6.0 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 83–94 C S B
28 South Carolina +5.5 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 87–95 C S B
29 Connecticut +6.0 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 90–97 C B
30 Wisconsin +13.0 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 78–94 C S B
31 Hawaii +2.0 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 88–95 C S B
32 Alabama +1.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 94–97 C S B
33 Kansas +4.0 vs normal 99 6.0 7-day fleet-score change -6.0 pts · range 71–83 C S B
34 Oklahoma +5.0 vs normal 99 6.0 7-day fleet-score change -6.0 pts · range 81–95 C S B
35 Louisiana +6.5 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 66–95 C S B
36 Nebraska +10.5 vs normal 99 4.0 7-day fleet-score change -4.0 pts · range 73–90 C S B
37 Vermont +1.0 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 96–98 S B
38 West Virginia +1.5 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 91–99 S B
39 Rhode Island +1.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 94–99 C S B
40 Delaware +2.0 vs normal 99 5.0 7-day fleet-score change -5.0 pts · range 90–99 C S B
41 New York +3.5 vs normal 98 0.0 7-day fleet-score change +0.0 pts · range 91–95 C S B
42 Colorado +2.0 vs normal 98 1.0 7-day fleet-score change -1.0 pts · range 88–93 C S B
43 Virginia +4.5 vs normal 98 2.0 7-day fleet-score change -2.0 pts · range 86–94 C S B
44 Minnesota +7.0 vs normal 98 4.0 7-day fleet-score change -4.0 pts · range 81–93 C S B
45 District of Columbia +1.0 vs normal 98 1.0 7-day fleet-score change +1.0 pts · range 84–86 C B
46 Maryland +3.0 vs normal 98 1.0 7-day fleet-score change -1.0 pts · range 90–96 C S B
47 Idaho +1.5 vs normal 98 1.0 7-day fleet-score change -1.0 pts · range 93–97 C S B
48 Missouri +5.0 vs normal 98 5.0 7-day fleet-score change -5.0 pts · range 81–94 C S B
49 Tennessee +3.0 vs normal 97 1.0 7-day fleet-score change -1.0 pts · range 87–92 C S B
50 Indiana +3.0 vs normal 96 3.0 7-day fleet-score change -3.0 pts · range 84–92 C S B
51 Oregon +1.0 vs normal · -6 vs always-on standard 92 1.0 7-day fleet-score change +1.0 pts · range 84–85 C S B

How we grade the weather

We grade a connection by how often it drops while the device is online — reconnects per online-hour — not by raw connectivity, so a device that sleeps to save power isn't punished for being offline by design. Internet health is that grade measured on always-on devices (online 90%+ of the day, where a reconnect is a real drop, never a scheduled wake), scored 0–100. Icons follow that number on one absolute scale — Clear at 95+, Partly cloudy from 85, Stormy below — the same bar everywhere, so “stormy” always means genuinely below standard, never “below its own usual”. A region's movement against its own recent trend is a secondary note, not the weather itself. The number cannot see an outage, though: a device that loses power stops reconnecting, so it grades fine until it drops out of view. So the icon also watches presence — the share of always-on devices that are offline at the sample — and turns cloudy or stormy when more of them are dark than that region's normal, whatever the surviving links score. Groups too small for an always-on cohort show a dash rather than a number on a different scale.

Today, and the last 24 hours

Each report covers the last 24 hours of devices seen — today's active fleet, not a rolling week — so the trend actually moves day to day. Time online counts devices that sleep by design, which is why it undersells the fleet; the honest measure of scale is the always-on share, the portion online 90%+ of the day. That same duty-cycling is the weekday/weekend rhythm you see in the trend bands. We report cellular vs. Starlink as an observed difference, not a verdict — usage and power still color it. And if most regions ever dip at once, we flag the day as a data anomaly instead of a global storm: the internet doesn't fail everywhere simultaneously, but a measurement pipeline can.

Confidence, privacy & sources

The Sample dots show how much data backs a row — a larger sample means a more reliable average (we never publish exact counts). Tables are ordered by the figure shown, with nothing hidden behind it, so a region running on a handful of devices can sit near the top on thin evidence — check its dots before drawing a conclusion. Aggregates only: any region with fewer than 20 devices is omitted, and a network-class row within a region needs at least 5 devices — below that, an “average” is close to one device's raw telemetry; no counts, IPs, or user data are ever published. World map: “Simple World Map” by Al MacDonald / Fritz Lekschas, CC BY-SA 3.0. US geometry: public-domain US Census cartographic boundaries (us-atlas).

Generated 2026-09-20T00:31:27.450Z · powered by remote.it

Search articles