Skip to content

NEW  Coming soon: ask your fleet a question and get an answer — an MCP server for AI.  Read more →

2026-08-31 · UTC

Internet weather report

A daily read on the public networks the remote.it fleet connects over —
Monday, August 31, 2026, worldwide. Global internet: operating normally.

Not a remote.it status page — we measure the local networks our devices connect over. “Stormy” means the internet there is running well below what an always-on connection should deliver.

Today's outlook

Four forecasts, one fleet.

Internet health, 0–100 — scored on always-on devices, where every drop is real.

Cellular
LTE / 4G / 5G
95 internet health
7-day history
Always-on
79%
Avg uptime
99.5%
Fleet
50k+
Time online
85.7%
Starlink
LEO satellite
99 internet health
7-day history
Always-on
70%
Avg uptime
99.5%
Fleet
10k+
Time online
82.5%
Broadband
Cable · DSL · fiber
98 internet health
7-day history
Always-on
89%
Avg uptime
99.8%
Fleet
50k+
Time online
93.0%
This week

The last seven days.

One point per day. The bands are the fleet's daily grade mix — that's where its weekday/weekend rhythm shows — while the health line holds to the always-on standard.

5075100☀️Tue☀️Wed☀️Thu☀️Fri☀️Sat☀️Sun☀️Today
Global Internet Health · Last 7 Days
DateInternet healthFleet mixTime onlineConditions
Tuesday, August 259778/12/1073.5%Clear
Wednesday, August 269778/12/1075.1%Clear
Thursday, August 279779/11/1076.6%Clear
Friday, August 289880/11/978.5%Clear
Saturday, August 299881/10/980.5%Clear
Sunday, August 309888/7/590.6%Clear
Monday, August 319788/7/690.0%Clear
World

Internet health by country.

Shaded by internet health. Grey means no reporting fleet today.

Simple World MapAuthor: Al MacDonald Editor: Fritz Lekschas License: CC BY-SA 3.0 ID: ISO 3166-1 or "_[a-zA-Z]" if an ISO code is not available
60 100 No data internet health
Networks
1 Netherlands +16.0 vs normal 100 16.0 7-day fleet-score change +16.0 pts · range 73–89 C S B
2 Switzerland +26.0 vs normal 100 26.0 7-day fleet-score change +26.0 pts · range 69–96 C S B
3 Czechia +14.0 vs normal 100 14.0 7-day fleet-score change +14.0 pts · range 76–91 C S B
4 Poland +25.0 vs normal 100 25.0 7-day fleet-score change +25.0 pts · range 63–90 C S B
5 Guatemala +2.0 vs normal 100 2.0 7-day fleet-score change +2.0 pts · range 96–99 C S B
6 South Korea +1.0 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 83–86 C B
7 Ireland +27.0 vs normal 100 28.0 7-day fleet-score change +28.0 pts · range 58–87 C S B
8 Portugal +9.0 vs normal 100 11.0 7-day fleet-score change +11.0 pts · range 82–96 C S B
9 Vietnam +3.0 vs normal 100 2.0 7-day fleet-score change +2.0 pts · range 89–93 C B
10 Iceland +3.0 vs normal 100 3.0 7-day fleet-score change +3.0 pts · range 79–86 C B
11 Slovenia +1.0 vs normal 100 2.0 7-day fleet-score change +2.0 pts · range 96–98 C B
12 Romania +12.5 vs normal 100 15.0 7-day fleet-score change +15.0 pts · range 71–86 C B
13 Lithuania +3.0 vs normal 100 4.0 7-day fleet-score change +4.0 pts · range 56–61 C B
14 Hungary +7.5 vs normal 100 10.0 7-day fleet-score change +10.0 pts · range 87–98 C B
15 Luxembourg +35.5 vs normal 100 37.0 7-day fleet-score change +37.0 pts · range 53–90 C B
16 Egypt +1.5 vs normal 100 6.0 7-day fleet-score change +6.0 pts · range 79–89 C B
17 Croatia -5.0 vs normal 100 4.0 7-day fleet-score change -4.0 pts · range 83–90 C S B
18 Costa Rica 0.0 vs normal 100 2.0 7-day fleet-score change -2.0 pts · range 90–96 S B
19 Bolivia -7.0 vs normal 100 7.0 7-day fleet-score change -7.0 pts · range 89–98 C S B
20 Maldives +1.0 vs normal 100 2.0 7-day fleet-score change +2.0 pts · range 91–93 C B
21 El Salvador 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 92–98 C B
22 Belarus -3.0 vs normal 100 5.0 7-day fleet-score change -5.0 pts · range 95–100 C B
23 Serbia +2.5 vs normal 100 3.0 7-day fleet-score change +3.0 pts · range 84–97 C B
24 Latvia +32.5 vs normal 100 37.0 7-day fleet-score change +37.0 pts · range 62–100 C B
25 Puerto Rico +3.0 vs normal 100 3.0 7-day fleet-score change +3.0 pts · range 91–98 S B
26 Cyprus +0.5 vs normal 100 5.0 7-day fleet-score change +5.0 pts · range 89–96 C B
27 Cambodia +5.0 vs normal 100 7.0 7-day fleet-score change +7.0 pts · range 87–96 B
28 Kuwait 0.0 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 81–93 C B
29 Dominican Republic +5.0 vs normal 100 5.0 7-day fleet-score change +5.0 pts · range 67–78 C B
30 Jordan -2.0 vs normal 100 2.0 7-day fleet-score change -2.0 pts · range 98–100 C B
31 Paraguay +5.0 vs normal 100 7.0 7-day fleet-score change +7.0 pts · range 61–81 B
32 Qatar -2.5 vs normal 100 2.0 7-day fleet-score change +2.0 pts · range 87–93 C B
33 Uruguay +3.5 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 69–80 B
34 Nepal +2.5 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 93–100 B
35 Côte d’Ivoire +4.5 vs normal 100 5.0 7-day fleet-score change +5.0 pts · range 78–91 C B
36 Senegal +17.5 vs normal 100 13.0 7-day fleet-score change +13.0 pts · range 61–88 C
37 Mongolia +0.5 vs normal 100 5.0 7-day fleet-score change +5.0 pts · range 82–91 C B
38 Bahamas 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts B
39 Sri Lanka +6.0 vs normal 100 6.0 7-day fleet-score change +6.0 pts · range 81–92 C B
40 Congo - Brazzaville -3.0 vs normal 100 3.0 7-day fleet-score change -3.0 pts · range 80–95 B
41 Oman +4.0 vs normal 100 10.0 7-day fleet-score change +10.0 pts · range 81–97 B
42 Tonga 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 94–100 C
43 New Caledonia -9.0 vs normal 100 10.0 7-day fleet-score change -10.0 pts · range 39–62 C B
44 Nicaragua +13.0 vs normal 100 9.0 7-day fleet-score change +9.0 pts · range 63–90 C S B
45 Kazakhstan +7.0 vs normal 100 10.0 7-day fleet-score change +10.0 pts · range 76–91 C B
46 U.S. Virgin Islands 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 93–100 S B
47 Honduras +1.0 vs normal 100 2.0 7-day fleet-score change -2.0 pts · range 85–93 B
48 Angola +6.0 vs normal 100 6.0 7-day fleet-score change +6.0 pts · range 52–60 C
49 Uganda -0.5 vs normal 100 1.0 7-day fleet-score change -1.0 pts · range 86–95 B
50 Montenegro 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts C B
51 French Polynesia 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts B
52 Trinidad & Tobago +9.0 vs normal 100 2.0 7-day fleet-score change +2.0 pts · range 91–100 B
53 Brunei 100 7.6 7-day fleet-score change +7.6 pts · range 87–95 · estimated B
54 Japan +3.0 vs normal 99 3.0 7-day fleet-score change +3.0 pts · range 86–95 C S B
55 Australia +6.0 vs normal 99 6.0 7-day fleet-score change +6.0 pts · range 63–71 C S B
56 Germany +17.0 vs normal 99 19.0 7-day fleet-score change +19.0 pts · range 76–95 C S B
57 Sweden +16.0 vs normal 99 18.0 7-day fleet-score change +18.0 pts · range 79–97 C S B
58 Mexico +3.0 vs normal 99 3.0 7-day fleet-score change +3.0 pts · range 92–95 C S B
59 Norway +11.5 vs normal 99 13.0 7-day fleet-score change +13.0 pts · range 84–97 C S B
60 Austria +26.0 vs normal 99 27.0 7-day fleet-score change +27.0 pts · range 66–93 C S B
61 Denmark +17.0 vs normal 99 18.0 7-day fleet-score change +18.0 pts · range 76–96 C B
62 Belgium +20.0 vs normal 99 21.0 7-day fleet-score change +21.0 pts · range 70–92 C S B
63 Chile +1.0 vs normal 99 2.0 7-day fleet-score change +2.0 pts · range 89–91 C S B
64 Philippines +2.0 vs normal 99 2.0 7-day fleet-score change +2.0 pts · range 75–83 C S B
65 Israel -0.5 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 92–95 C B
66 Finland +9.0 vs normal 99 11.0 7-day fleet-score change +11.0 pts · range 75–86 C B
67 Ukraine 0.0 vs normal 99 1.0 7-day fleet-score change +1.0 pts · range 92–95 C S B
68 Ecuador +21.0 vs normal 99 20.0 7-day fleet-score change +20.0 pts · range 74–96 C B
69 Hong Kong SAR China +1.5 vs normal 99 1.0 7-day fleet-score change +1.0 pts · range 93–96 C B
70 Argentina 0.0 vs normal 99 5.0 7-day fleet-score change +5.0 pts · range 82–90 C S B
71 Nigeria +10.0 vs normal 99 15.0 7-day fleet-score change +15.0 pts · range 59–84 C S B
72 United States +5.0 vs normal 98 5.0 7-day fleet-score change +5.0 pts · range 89–94 C S B
73 United Kingdom +7.0 vs normal 98 7.0 7-day fleet-score change +7.0 pts · range 88–95 C S B
74 Italy +8.0 vs normal 98 13.0 7-day fleet-score change +13.0 pts · range 80–94 C S B
75 Colombia +1.0 vs normal 98 1.0 7-day fleet-score change +1.0 pts · range 90–92 C S B
76 Slovakia +2.0 vs normal 98 2.0 7-day fleet-score change +2.0 pts · range 91–94 C S B
77 France +14.5 vs normal 98 15.0 7-day fleet-score change +15.0 pts · range 78–94 C S B
78 Indonesia +0.5 vs normal 98 5.0 7-day fleet-score change +5.0 pts · range 85–90 C S B
79 Malaysia +2.0 vs normal 98 2.0 7-day fleet-score change +2.0 pts · range 90–94 C S B
80 Saudi Arabia 0.0 vs normal 98 1.0 7-day fleet-score change -1.0 pts · range 86–93 C B
81 Guernsey +22.0 vs normal 98 22.0 7-day fleet-score change +22.0 pts · range 65–94 C B
82 Estonia +4.0 vs normal 98 5.0 7-day fleet-score change +5.0 pts · range 88–94 C B
83 Greece -1.5 vs normal 98 2.0 7-day fleet-score change -2.0 pts · range 91–94 C S B
84 Iran +27.5 vs normal 98 23.0 7-day fleet-score change +23.0 pts · range 50–89 C B
85 Malta +6.5 vs normal 98 16.0 7-day fleet-score change +16.0 pts · range 75–93 C B
86 Taiwan +1.0 vs normal 98 3.0 7-day fleet-score change +3.0 pts · range 88–91 C B
87 Panama +1.0 vs normal 98 1.0 7-day fleet-score change +1.0 pts · range 93–96 S B
88 Brazil +2.0 vs normal 97 2.0 7-day fleet-score change +2.0 pts · range 86–93 C S B
89 Türkiye +2.0 vs normal 97 4.0 7-day fleet-score change +4.0 pts · range 74–78 C B
90 Venezuela -3.0 vs normal 97 7.0 7-day fleet-score change -7.0 pts · range 88–95 C S B
91 Isle of Man +3.5 vs normal 97 6.0 7-day fleet-score change +6.0 pts · range 86–97 C B
92 Yemen -14.0 vs normal 97 15.0 7-day fleet-score change -15.0 pts · range 47–89 S B
93 Thailand -1.0 vs normal 96 1.0 7-day fleet-score change -1.0 pts · range 92–93 C B
94 Canada +5.0 vs normal 96 5.0 7-day fleet-score change +5.0 pts · range 80–85 C S B
95 Peru +6.0 vs normal 96 3.0 7-day fleet-score change +3.0 pts · range 87–92 C S B
96 Spain +14.0 vs normal 96 15.0 7-day fleet-score change +15.0 pts · range 67–83 C S B
97 South Africa +8.0 vs normal 96 9.0 7-day fleet-score change +9.0 pts · range 78–89 C B
98 Jersey +7.0 vs normal 96 7.0 7-day fleet-score change +7.0 pts · range 66–88 B
99 Bulgaria +2.0 vs normal 96 4.0 7-day fleet-score change +4.0 pts · range 79–86 C S B
100 Kenya +2.5 vs normal 96 3.0 7-day fleet-score change +3.0 pts · range 78–89 C S B
101 Bosnia & Herzegovina -2.0 vs normal 96 3.0 7-day fleet-score change -3.0 pts · range 81–86 C B
102 Tanzania +10.0 vs normal 96 13.0 7-day fleet-score change +13.0 pts · range 73–91 C B
103 Singapore +3.0 vs normal 95 4.0 7-day fleet-score change +4.0 pts · range 87–91 C B
104 New Zealand +1.5 vs normal 95 2.0 7-day fleet-score change +2.0 pts · range 73–83 C S B
105 Morocco +7.0 vs normal 95 10.0 7-day fleet-score change +10.0 pts · range 81–92 C B
106 United Arab Emirates +1.0 vs normal 94 0.0 7-day fleet-score change +0.0 pts · range 89–91 C B
107 Pakistan +0.5 vs normal 94 3.0 7-day fleet-score change +3.0 pts · range 83–89 C B
108 China +2.0 vs normal 94 5.0 7-day fleet-score change +5.0 pts · range 78–84 C B
109 Papua New Guinea -0.5 vs normal 94 12.0 7-day fleet-score change +12.0 pts · range 69–82 C B
110 Bahrain -7.0 vs normal · -5 vs always-on standard 93 7.0 7-day fleet-score change -7.0 pts · range 93–100 C B
111 Tunisia -15.5 vs normal · -6 vs always-on standard 92 19.0 7-day fleet-score change -19.0 pts · range 68–87 C B
112 India +2.0 vs normal · -7 vs always-on standard 91 2.0 7-day fleet-score change +2.0 pts · range 85–87 C B
113 Iraq -2.0 vs normal · -11 vs always-on standard 87 0.0 7-day fleet-score change +0.0 pts · range 72–79 C B
114 Bangladesh -7.5 vs normal · -14 vs always-on standard 84 8.0 7-day fleet-score change -8.0 pts · range 52–65 C B
115 Ghana -3.0 vs normal · -18 vs always-on standard 80 8.0 7-day fleet-score change -8.0 pts · range 35–47 C
116 Myanmar (Burma) -16.0 vs normal · -23 vs always-on standard 75 15.0 7-day fleet-score change -15.0 pts · range 51–76 C B
117 Russia -1.0 vs normal · -26 vs always-on standard 72 2.0 7-day fleet-score change -2.0 pts · range 40–50 C B
118 Algeria -19.0 vs normal · -29 vs always-on standard 69 29.0 7-day fleet-score change -29.0 pts · range 46–87 C B
United States

Internet health by state.

Shaded by internet health. Territories appear in the table.

TXCAMTNMAZNVCOWYORUTMNIDKSSDNEAKNDOKMOWAGAFLMIILIAWIARALNCNYMSLAPATNOHVAKYINMESCWVMDVTNHMANJHICTDERIDC
60 100 No data internet health
Networks
1 Kentucky +1.0 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 95–97 C S B
2 South Carolina +7.0 vs normal 100 10.0 7-day fleet-score change +10.0 pts · range 85–95 C S B
3 Connecticut +9.0 vs normal 100 10.0 7-day fleet-score change +10.0 pts · range 89–99 C S B
4 Hawaii +8.0 vs normal 100 7.0 7-day fleet-score change +7.0 pts · range 87–97 C S B
5 Louisiana +9.5 vs normal 100 31.0 7-day fleet-score change +31.0 pts · range 64–95 C S B
6 Oklahoma +8.5 vs normal 100 9.0 7-day fleet-score change +9.0 pts · range 82–94 C S B
7 Montana +3.0 vs normal 100 6.0 7-day fleet-score change +6.0 pts · range 92–98 S B
8 New Mexico +4.0 vs normal 100 5.0 7-day fleet-score change +5.0 pts · range 89–96 C S B
9 Delaware +10.0 vs normal 100 11.0 7-day fleet-score change +11.0 pts · range 87–99 C S B
10 Alaska +7.0 vs normal 100 3.0 7-day fleet-score change +3.0 pts · range 61–72 C S B
11 Wyoming +1.0 vs normal 100 2.0 7-day fleet-score change +2.0 pts · range 78–87 S B
12 South Dakota +11.5 vs normal 100 15.0 7-day fleet-score change +15.0 pts · range 82–97 S B
13 North Dakota +17.5 vs normal 100 28.0 7-day fleet-score change +28.0 pts · range 72–100 B
14 California +2.0 vs normal 99 2.0 7-day fleet-score change +2.0 pts · range 93–96 C S B
15 Texas +4.0 vs normal 99 4.0 7-day fleet-score change +4.0 pts · range 90–95 C S B
16 Georgia +4.0 vs normal 99 5.0 7-day fleet-score change +5.0 pts · range 87–92 C S B
17 Florida +8.0 vs normal 99 9.0 7-day fleet-score change +9.0 pts · range 88–97 C S B
18 Washington +3.0 vs normal 99 3.0 7-day fleet-score change +3.0 pts · range 93–96 C S B
19 Massachusetts +3.0 vs normal 99 3.0 7-day fleet-score change +3.0 pts · range 93–97 C S B
20 Virginia +7.0 vs normal 99 8.0 7-day fleet-score change +8.0 pts · range 86–94 C S B
21 Minnesota +12.5 vs normal 99 13.0 7-day fleet-score change +13.0 pts · range 80–93 C S B
22 Nevada +4.0 vs normal 99 5.0 7-day fleet-score change +5.0 pts · range 88–93 C S B
23 Pennsylvania +5.5 vs normal 99 8.0 7-day fleet-score change +8.0 pts · range 81–89 C S B
24 Arizona +7.0 vs normal 99 7.0 7-day fleet-score change +7.0 pts · range 87–95 C S B
25 North Carolina +11.0 vs normal 99 13.0 7-day fleet-score change +13.0 pts · range 81–94 C S B
26 Maryland +5.0 vs normal 99 5.0 7-day fleet-score change +5.0 pts · range 90–97 C S B
27 Michigan +12.0 vs normal 99 12.0 7-day fleet-score change +12.0 pts · range 81–95 C S B
28 Ohio +14.0 vs normal 99 15.0 7-day fleet-score change +15.0 pts · range 81–100 C S B
29 Utah +7.0 vs normal 99 8.0 7-day fleet-score change +8.0 pts · range 86–94 C S B
30 Wisconsin +14.0 vs normal 99 15.0 7-day fleet-score change +15.0 pts · range 80–95 C S B
31 Idaho +3.0 vs normal 99 4.0 7-day fleet-score change +4.0 pts · range 93–97 C S B
32 Alabama +2.0 vs normal 99 2.0 7-day fleet-score change +2.0 pts · range 93–97 C S B
33 Missouri +11.0 vs normal 99 13.0 7-day fleet-score change +13.0 pts · range 82–95 C S B
34 Nebraska +11.5 vs normal 99 14.0 7-day fleet-score change +14.0 pts · range 72–86 C S B
35 Vermont +2.0 vs normal 99 2.0 7-day fleet-score change +2.0 pts · range 95–97 S B
36 New Hampshire +1.0 vs normal 99 2.0 7-day fleet-score change +2.0 pts · range 96–99 S B
37 Iowa +8.0 vs normal 99 10.0 7-day fleet-score change +10.0 pts · range 78–91 C S B
38 Kansas +15.5 vs normal 99 13.0 7-day fleet-score change +13.0 pts · range 71–91 C S B
39 Maine +3.0 vs normal 99 4.0 7-day fleet-score change +4.0 pts · range 92–98 S B
40 West Virginia +2.5 vs normal 99 2.0 7-day fleet-score change +2.0 pts · range 94–98 S B
41 Mississippi +17.0 vs normal 99 16.0 7-day fleet-score change +16.0 pts · range 71–97 C S B
42 Rhode Island +3.5 vs normal 99 7.0 7-day fleet-score change +7.0 pts · range 91–99 C S B
43 Arkansas +9.0 vs normal 99 6.0 7-day fleet-score change +6.0 pts · range 79–94 S B
44 New York +6.0 vs normal 98 5.0 7-day fleet-score change +5.0 pts · range 90–96 C S B
45 Colorado +4.0 vs normal 98 4.0 7-day fleet-score change +4.0 pts · range 89–94 C S B
46 Illinois +7.0 vs normal 98 9.0 7-day fleet-score change +9.0 pts · range 83–92 C S B
47 New Jersey +1.0 vs normal 98 1.0 7-day fleet-score change +1.0 pts · range 87–89 C S B
48 Tennessee +5.0 vs normal 98 5.0 7-day fleet-score change +5.0 pts · range 84–91 C S B
49 District of Columbia 0.0 vs normal 98 1.0 7-day fleet-score change +1.0 pts · range 84–87 C B
50 Indiana +8.0 vs normal 96 9.0 7-day fleet-score change +9.0 pts · range 83–93 C S B
51 Oregon +1.0 vs normal · -5 vs always-on standard 93 1.0 7-day fleet-score change +1.0 pts · range 83–85 C S B

How we grade the weather

We grade a connection by how often it drops while the device is online — reconnects per online-hour — not by raw connectivity, so a device that sleeps to save power isn't punished for being offline by design. Internet health is that grade measured on always-on devices (online 90%+ of the day, where a reconnect is a real drop, never a scheduled wake), scored 0–100. Icons follow that number on one absolute scale — Clear at 95+, Partly cloudy from 85, Stormy below — the same bar everywhere, so “stormy” always means genuinely below standard, never “below its own usual”. A region's movement against its own recent trend is a secondary note, not the weather itself. Groups too small for an always-on cohort report their whole-fleet composite until one exists.

Today, and the last 24 hours

Each report covers the last 24 hours of devices seen — today's active fleet, not a rolling week — so the trend actually moves day to day. Time online counts devices that sleep by design, which is why it undersells the fleet; the honest measure of scale is the always-on share, the portion online 90%+ of the day. That same duty-cycling is the weekday/weekend rhythm you see in the trend bands. We report cellular vs. Starlink as an observed difference, not a verdict — usage and power still color it. And if most regions ever dip at once, we flag the day as a data anomaly instead of a global storm: the internet doesn't fail everywhere simultaneously, but a measurement pipeline can.

Confidence, privacy & sources

The Sample dots show how much data backs a row — a larger sample means a more reliable average (we never publish exact counts). Tables are ordered by the figure shown, with nothing hidden behind it, so a region running on a handful of devices can sit near the top on thin evidence — check its dots before drawing a conclusion. Aggregates only: any region with fewer than 20 devices is omitted, and a network-class row within a region needs at least 5 devices — below that, an “average” is close to one device's raw telemetry; no counts, IPs, or user data are ever published. World map: “Simple World Map” by Al MacDonald / Fritz Lekschas, CC BY-SA 3.0. US geometry: public-domain US Census cartographic boundaries (us-atlas).

Generated 2026-08-31T00:31:26.078Z · powered by remote.it

Search articles